DPCstruct | MC24275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 159 |
|---|---|
| Mean domain length (aa) | 186 ± 41 aa |
| Standard deviation of domain lengths | 40.56 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 18.37 |
| Pfam Score | 79.14 |
| Assigned Pfam label(s) | CL0020- PF05278- CL0072- CL0389- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U8K2C6 | 1-168 | TVKAELAPILKAVLLKHGDIVTDCSLNSTQCRSSLLEIAFGIIQKLQAAKLEDLTEPELRSMLASVSDLESLKLRVSWLRKRLDQII… |
| A0A5N6RGM3 | 197-399 | TTEKIEAYDHDEIILFSDKAYTQFIKFLNYSEVSHNMFPYDWNVGSHTKEEVINVGDYMTTRKLAPILNHLLSNHGDIGAESMFSPK… |
| A0A803Q9C2 | 28-242 | None |
| A0A5J5UT43 | 6-164 | None |
| A0A0D3CUJ8 | 14-178 | None |
| A0A6A6LKU8 | 66-276 | None |
| A0A2N9IAV8 | 345-550 | None |
| A0A2N9IL65 | 710-946 | None |
| A0A2U1QNQ8 | 374-583 | None |
| A0A6P4AXR4 | 26-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.