DPCstruct | MC24270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 262 ± 56 aa |
| Standard deviation of domain lengths | 56.39 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12295 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0AN00 | 14-330 | ESNEYSPSAATNYEKFLFSIAKGLLDALPASDKSFSRLLGEAPFLSVSILELLEDVCCSGDGDRITQGLAAIWNLILSRPSNRLACL… |
| A0A4Y0BH31 | 78-305 | MQIVKDLLIRRPPRERQYLDILLKYSYYENGTIREKAIEYVMNVFAVHRIMTEQIEKNALSWLAYLEHENPTESMFAVEYGRAEHPR… |
| A0A453AJD4 | 698-895 | None |
| A0A7R9Z069 | 2-258 | None |
| A0A7J7MSM8 | 641-959 | None |
| A0A671P8T0 | 461-686 | None |
| A0A182ESR9 | 142-408 | None |
| U9SNY1 | 42-272 | None |
| A0A1W0A5T4 | 286-687 | None |
| A0A7C8YK99 | 2-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.