DPCstruct | MC24269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 129 ± 35 aa |
| Standard deviation of domain lengths | 35.01 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 74.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0048 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9EBT2 | 19-154 | QHRKSLPPPRRTTVTWEEYINAAAGLAPSLGRAQVLKQNTKKFKALVAMAEDFPLSIDVLLDILEIVAPFKHFDKLRCFCKVRMPPG… |
| A0A7S3VT28 | 1-129 | EEEEEEEEEEREGAPPPASFKATPEQLKQYKRLSGRCWMANKFPLSLKQILPVLQLIGGANKHFYKVESFMSNYADREEFPVRVDIP… |
| D0MTB8 | 40-143 | None |
| A0A7S4NF13 | 3-118 | None |
| A0A7R9FMX5 | 277-453 | None |
| Q8LFL1 | 150-299 | None |
| D7FKT2 | 134-217 | None |
| A0A131ZU07 | 210-296 | None |
| S4P871 | 1-85 | None |
| A0A7J8YJC2 | 164-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.