DPCstruct | MC24264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 108 ± 18 aa |
| Standard deviation of domain lengths | 18.27 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 51.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00239 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438M6E4 | 2-96 | SDGDFQRVEASDCPMSSCAAPAGSPCRTGRGKVAAQYHTARFRLVPSLARALNVPTPALRKPGSAWIELPRLAASGTTSGHAKIGYA… |
| A0A1L7F8P1 | 111-226 | IQLGPDDAAAERHPCPQCDVPAGSACGTRAGKTAAKYHTARFILVPSLRDELTVAVPADRGPGKKWTQGPEVAATAPETSGVPIRIG… |
| A0A2S2GH03 | 1-107 | None |
| A0A1S6RBP1 | 1-99 | None |
| A0A4D4KHR9 | 1-107 | None |
| A0A495H3X0 | 6-111 | None |
| A0A0N1JWZ1 | 8-111 | None |
| A0A7W9NS25 | 1-107 | None |
| A0A239N983 | 7-93 | None |
| A0A5B7V9U3 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.