DPCstruct | MC24263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 79 ± 15 aa |
| Standard deviation of domain lengths | 14.50 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A642VE81 | 11-91 | IERRVSVLRYDNTIGIVVEQDRPKDVVDTLRWYCKNCSEIVYEASFHMYDLGTQIKETIADFDSDITKRTCKNCGTVATSK |
| A0A7Z9U8H8 | 2-63 | RPKGTTDKLRWYCPDDIHLVHEASFRLEHIDEDLHKVMDEFWNGPEEIRTCKETGKVIERAG |
| A0A4Q4YJ35 | 106-170 | None |
| A0A4Q3ZKC9 | 103-185 | None |
| A0A838NE47 | 1-59 | None |
| A0A819BHT1 | 1085-1147 | None |
| A0A1D7XRB6 | 49-132 | None |
| A0A401YXU9 | 287-348 | None |
| A0A0D8Y408 | 16-102 | None |
| I7ZQ56 | 25-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.