DPCstruct | MC24261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 560 ± 95 aa |
| Standard deviation of domain lengths | 94.57 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.99 |
| Pfam Score | 93.41 |
| Assigned Pfam label(s) | CL0110- PF00173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A642VAI3 | 502-1081 | GSDYGEESVIPYDCSFEDYEVDSLNREYLDRPTAADYGYDTEAVGQQTLQKLSGRRKLWLVIVKLLTWWIPSPLLSIGGMKRSEVRI… |
| A0A0C3JAF3 | 27-383 | NPNNVYMLNRGGVFDLTAVAATHQRVFSMVSTKSVLQYGGMASDAIFPVQVSALCNGVSGSVSPWVTLDSANNTDPNAQYHDFRAFT… |
| J4U549 | 11-548 | None |
| A0A1Y1YBA2 | 3-403 | None |
| A0A167CJS4 | 385-1097 | None |
| J9VNT4 | 831-1373 | None |
| U9UWN8 | 1-457 | None |
| K0SH62 | 204-799 | None |
| A0A015KZG8 | 279-808 | None |
| A0A5C2SZV5 | 112-634 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.