DPCstruct | MC2426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 148 ± 17 aa |
| Standard deviation of domain lengths | 17.22 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A352XLD1 | 4-113 | SNGLTWEKITIELAGNQSIRIKAPGQDKIHSFSKRSKLSKHHPLGILIQIGSKGYWENPPTYAAEYERVSKSFQRFRALLRELIPLA… |
| A0A6M5YH51 | 24-181 | PGQPYRARFTIRRAGPATFPTPPGATWGAVSLTETGPGVVEAAVTTRGRGVARVRGDGPGDRGRWEGTTQDDERRLRYTLRDLGMTG… |
| A0A2E8EYN7 | 12-170 | None |
| A0A7X8WCF4 | 109-283 | None |
| A0A419FAH2 | 445-600 | None |
| A0A2M7Q608 | 632-789 | None |
| A0A1E7HZW8 | 118-279 | None |
| A0A2E8Q147 | 196-350 | None |
| A0A7C7W2Z9 | 76-215 | None |
| A0A1F6CQL2 | 117-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.