DPCstruct | MC24257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 6.64 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 37.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D8BYX6 | 82-160 | MYRGEKFPGLNKPKRAPKGSKKKYRVLAHQKGKYKIVSFGARGYKDFLQHKNKKRRSNFKSRHNCDKKKNKLTAGYWAC |
| A0A6C0BYU8 | 479-578 | KERIIKFMRGPGEKKYTARIMHKKTRKIRHIHFGAKGYEQFKDSTPLGLYSSKNHGTKKRRDNYFSRHSGIKNKKKALAKEIRKSKG… |
| A0A2E7V4J8 | 79-160 | None |
| A0A3R7S3D1 | 19-107 | None |
| A0A080Z461 | 188-271 | None |
| A0A7Y1VPG0 | 14-106 | None |
| A0A6C0H3A0 | 8-92 | None |
| A0A6C0H0X1 | 1-83 | None |
| A0A2E0BR58 | 39-123 | None |
| A0A6C0IA48 | 149-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.