DPCstruct | MC24255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 118 ± 13 aa |
| Standard deviation of domain lengths | 12.80 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848WP04 | 400-505 | TGEGYEEWANKLGNIEEMLEQEDLRNEIAKVLDNARAMRIDYRRDNLPPQVNAIETRITNPLVELRNQLTEELAKLDKDNPLAPIDR… |
| A0A3C1H6H0 | 7-127 | PATDAGLAGGPLTGEDYSQWADRLRDVEEMLDDPVLRGQVAQVREQARQLRSDYKKHAKDPQWDLVKTKIIAPLAEVRQKVNDELAR… |
| A0A7X7U1N9 | 450-575 | None |
| A0A3E1EFC5 | 982-1109 | None |
| A0A350F2Y0 | 157-287 | None |
| A0A4Q2Y790 | 1-109 | None |
| A0A3C1QV55 | 13-141 | None |
| A0A3D6CZC0 | 801-927 | None |
| A0A2D7L2H6 | 1-107 | None |
| A0A7Y2AP48 | 63-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.