DPCstruct | MC24254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 117 ± 18 aa |
| Standard deviation of domain lengths | 17.66 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A327KFU2 | 3-105 | DRVGKLLEQFGRHDSLLEMGDYSIYGDYWGFPQVKVTVENLKLLRPDIVERLQGVVADFPGWEIVVAVAVPEHISDWPDMGLYIRPH… |
| A0A3C1ASM2 | 23-127 | VINSPEDEAAFISEWDGVRERLMQTLDALGEWNAYGEGDYYIGDQVMQSRGIGIELTSDMMLDKKLIPLIQSSLHGCTSSYEVYCSF… |
| A0A5C5XD53 | 67-203 | None |
| A0A7T9IM81 | 116-216 | None |
| A2SCP6 | 2-100 | None |
| A0A366HGY4 | 27-128 | None |
| A0A5Q3LB85 | 1-156 | None |
| A0A2S0NFL7 | 8-127 | None |
| A0A8A7V7A1 | 65-158 | None |
| A0A0S3PZC5 | 7-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.