DPCstruct | MC24252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 150 ± 8 aa |
| Standard deviation of domain lengths | 8.23 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 72.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 54.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4M364 | 1-144 | MDLETENRIASILLREAAELRRQAEKDGVRAYLEKPNVRHRPNSRFLTATVLGVQQSNKAVETNEMWRARQKEIELEDERLKRETRE… |
| A0A3B6SKJ3 | 1-146 | MDLGTENRLAALLLEEARRLRMQVEKEGVHAYLQKPNVRHRPYSRFLAATVLGVHQANRVVEVNEMWRAREKELELELKMKTRTNGR… |
| A0A835R629 | 1-156 | None |
| A0A2K2C5C3 | 1-148 | None |
| A0A453SLL5 | 64-210 | None |
| G7IFC3 | 1-144 | None |
| A0A5B6ZA34 | 1-173 | None |
| A0A1U8DWI5 | 1-143 | None |
| A0A6J5VSX5 | 56-203 | None |
| A0A6A6N8E1 | 1-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.