DPCstruct | MC24250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 193 ± 35 aa |
| Standard deviation of domain lengths | 34.86 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2PU13 | 6-147 | VERVSLAVAQDKDWLSDLDCFIREQVEVFCANSSDVSKAVEYVPVSPGQVGLRCIHCAKSDEGAKGDAVLYPHSVSGIYESVRELHR… |
| A0A7S3DXD6 | 5-193 | PALTNSVTAASKAPVVPPEEEYSAVSPVDGYPLRLPALLAQPDDHLKLSTHQALLRQNIEAFEATPDDATIHARGRNRAILAGQVGI… |
| B8CER5 | 181-353 | None |
| A0A1Z9BXE0 | 71-285 | None |
| A0A7S2EBX6 | 99-316 | None |
| A0A7S1ZSG7 | 71-335 | None |
| A0A448Z6H9 | 144-354 | None |
| A0A6T9Z5Y5 | 2-147 | None |
| B5Y3D0 | 393-615 | None |
| A0A1E7EVC4 | 652-844 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.