DPCstruct | MC2425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 134 ± 16 aa |
| Standard deviation of domain lengths | 15.66 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.83 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B7GMP9 | 13-135 | ADEESDSDEETAVPDRTPEPEPEPEPEPEPATDPGDDETKDEPRDPTETGPAFPYSEVKQSPLYAREETWKQFDLEVDTTVVPELRK… |
| L9X1D5 | 3-128 | NPFDDLEAETAESPNVEDDEETVETAFVDEESVESEDAKDAGSVESTPAESGPAFEYDAVRQRPLYARGETWDAFEKKLRTTITPTL… |
| A0A1I0QYN7 | 3-116 | None |
| A0A2R6IHM2 | 1-148 | None |
| M0LC02 | 3-138 | None |
| A0A0U5CYC3 | 1-137 | None |
| A0A419W093 | 3-169 | None |
| A0A830G3T1 | 2-118 | None |
| A0A6B0SQA9 | 24-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.