DPCstruct | MC24248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 175 ± 16 aa |
| Standard deviation of domain lengths | 16.29 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2K215 | 283-456 | FRRHFADVLIFDIHDFEGDLTANFLCRVLNVKHTCAAQITKSEMEQVKSRNLSVDLHYDILVVAAYEAGYLLNQNLKRMDVVAKAKD… |
| A0A7S3DUA1 | 34-213 | YGEYFDVQVMNMHDTTKYKTLASQMVCDFIPNATKTCALSQVEEKDNKTASTVLNAAKSGYYDMLAMAANAKGLIDVDSDPERLTRP… |
| A0A7S1UXC1 | 5-202 | None |
| B5YM06 | 221-379 | None |
| A0A7S0GC23 | 49-224 | None |
| A0A1E7F4B9 | 4-169 | None |
| A0A7S2E7S8 | 26-202 | None |
| A0A448ZFG5 | 55-229 | None |
| A0A7S2E015 | 5-142 | None |
| A0A7R9ZQB2 | 215-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.