DPCstruct | MC24244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 139 ± 10 aa |
| Standard deviation of domain lengths | 10.23 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2LUK9 | 102-233 | TLKRQSVKKPSANLKLHIISQMKMNYIIATEIVGRISLSDMGDSTKCEFAADEYKRCCDRWKIPFAARQPFLLAAVKVFFIAGEQNV… |
| A0A7S2P8N3 | 195-339 | HHRSTSTGTISSLSGPTYSLSLRIKVQEFLAYIIAKDICFCTCAIAMKENDITMSLAGSMVKDLMDKWLIPKKSRFVFQTAATSMMF… |
| A0A7S3VAY6 | 5-134 | None |
| A0A1E7F8X0 | 670-827 | None |
| K0TM36 | 42-181 | None |
| B7S4E1 | 489-617 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.