DPCstruct | MC24243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 140 ± 13 aa |
| Standard deviation of domain lengths | 13.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H7N070 | 14-158 | WIETVRRVLYPWLHPYLSLLGGYSVGHVGFDQYVYHFDEDEEAIEDELVAVGGERNPIACLKSLPDGRVSEGSWRFTHATDPTGLVE… |
| A0A1F6V2B5 | 12-121 | RLFTSGDRQGFHVGWLASGKSLGDLRVHLHKEWGFGGNFSTKIEKGEVLSWRKLLNKKEQYHLRVFEDGEIRGHFEYTPEAHPLEHL… |
| A0A238UMY4 | 14-188 | None |
| A0A1H6AK11 | 31-185 | None |
| A0A0F9BZA6 | 2-121 | None |
| L9ZY39 | 25-172 | None |
| V4H9R0 | 2-155 | None |
| A0A1F6CKK4 | 25-169 | None |
| A0A3A4YKV6 | 10-146 | None |
| A0A1G2ME23 | 348-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.