DPCstruct | MC24240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 95 ± 18 aa |
| Standard deviation of domain lengths | 17.61 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A244D6U3 | 1-115 | MGNTGYKFFTKLELYYTDDNSSAGEIKDNLISDVDYIAPILDTRFCPPSPRYYSTLSTLDKIKECPNGQKGSTVTLTAYPNMFLSNS… |
| A0A1Q3TK33 | 52-116 | TWTNQAQSGNFTRNNCPPNYTGSSVTYNVAANTYNSTISLADANQKAIDDVNANGQSYANTNGTC |
| A0A3C0B0H2 | 102-187 | None |
| A0A3C1BFU1 | 323-427 | None |
| A0A2N0XE54 | 1066-1163 | None |
| A0A1V9FZB4 | 4-80 | None |
| A0A3G6MLL9 | 91-205 | None |
| A0A502DYV2 | 341-452 | None |
| A0A1J7CRF7 | 13-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.