DPCstruct | MC24239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 7.40 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 45.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5AVT7 | 7-82 | YNELRAYTTKICAPLKTEDFIPQPAIFASPIKWHLAHTTWFFETFILMKFLPNYKIFNSKFSFLFNSYYNNAGERL |
| A0A4U6D568 | 1-85 | MVNNLLTKYEAVRQLTGEICRPLEKEDYVVQPTLDVSPPKWHLGHTTWFFETFILLSFLPEYKEFNSQHNFVFNSYYETVGAREC |
| A0A848QCN8 | 1-90 | None |
| A0A090WR81 | 5-84 | None |
| A0A2A2KEI6 | 1-91 | None |
| A0A0C1H5I2 | 2-76 | None |
| A0A075FHS4 | 1-91 | None |
| A0A455U758 | 3-101 | None |
| A0A2U1RPP9 | 7-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.