DPCstruct | MC24237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 165 ± 17 aa |
| Standard deviation of domain lengths | 16.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15639 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W5TZA4 | 1-147 | MIVAPAFVKQYPRLATWICDNLPRVKDKQKVFRAFQKYSRLNEKVSERALQHGNPPTIEYRYLPADNGIFIGNKYPGTVFLSMSICD… |
| A0A1G9Q2D9 | 3-169 | MDAKAIREYPYLDAFLRGLGDRVARNPTVQKAFRDASTVVDAVADQALVFGNDPGVLPGDIGARYGRYDPAKARTVIFIDQGFEQML… |
| A0A4R5F762 | 97-275 | None |
| A0A1I2JB94 | 148-311 | None |
| A0A2P8D0X7 | 121-311 | None |
| A0A4U1CUK7 | 72-250 | None |
| A0A2W7HEB2 | 7-145 | None |
| A0A4Q8UA70 | 4-150 | None |
| A0A3C1RD73 | 165-317 | None |
| A0A2N3T3C6 | 483-651 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.