DPCstruct | MC24236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 236 ± 29 aa |
| Standard deviation of domain lengths | 28.75 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378CGF1 | 11-243 | WLNAFFSSRSLPGADGRALYAYRCHDAEYESLAALLRAHVPRNYPKTIFISYSDVLFSIYAAEFIRRNHTAGHPRWDVILESIGWKV… |
| A0A1G9KFU7 | 3-204 | ETVLERDGNALDGRPLHHFRVTDSEYDLLQLQLISLFQRGQQKTASAPFVLWAAERYRRDFDGGVFSWSFLVDPLGHKPDQAELREM… |
| A0A7Y3J001 | 7-257 | None |
| G1VDZ8 | 7-218 | None |
| A0A529U114 | 71-324 | None |
| A0A1B1I890 | 13-257 | None |
| A0A4R7E2C3 | 15-207 | None |
| A0A402VWA7 | 11-254 | None |
| A0A1S7DQ39 | 3-203 | None |
| A0A149US10 | 1-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.