DPCstruct | MC24234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 111 ± 12 aa |
| Standard deviation of domain lengths | 12.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S3PSM6 | 1-94 | MFGINATADATNRLAVQSDASLFNNAGKGHQIKLNKATTGDTVSFLFQTGWSGRAEVGATGDDKLHFKVSPDGSTWREGLIIDGAAY… |
| A0A2W4PUQ5 | 2-115 | ESAPPTELHDLVGLGVGTRPDAANAFAAKLENALWSARYAGEGGSGVLRMVLNKEDPADTASLIFQTDWSGRAEMGLAGSDDFTIKV… |
| U1XGI5 | 56-193 | None |
| A0A2G2MSN0 | 120-242 | None |
| A0A2D2CWJ8 | 123-231 | None |
| A0A1X7NWA9 | 121-223 | None |
| A3V2Y8 | 40-158 | None |
| A0A0P6WI96 | 121-239 | None |
| A0A6N1VDI3 | 113-219 | None |
| A0A7W6CXA5 | 114-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.