DPCstruct | MC24232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 6.75 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 58.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N3R6B3 | 52-145 | DETSVDDIAFTRKGLTSEVVAAVAKICSNADLIYGAKKMPVIKKANTTIGIPGTFSARLQPNDTRDDVQSIAAQIYEGLSFGVGDAV… |
| A0A1G8S195 | 1-91 | MAAVVSKIMRNRDLTAVAHKVEVIAAFRTTLGLPGRLGSRLQPNHPADHLAGTAASTLDGLTLGVGDAVIGVNLAPDNIDTATRSRR… |
| A0A133Z343 | 112-200 | None |
| A0A379VM71 | 53-149 | None |
| A0A1M7KWJ2 | 5-102 | None |
| A0A381GB19 | 15-100 | None |
| A0A350T2D4 | 106-198 | None |
| A0A377Z8A0 | 106-202 | None |
| A0A158JVB9 | 1-113 | None |
| A0A5C9BTB2 | 346-441 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.