DPCstruct | MC24231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 3.60 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 89.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7T3H6 | 59-130 | LKALEAALKNRDLGFDATELEQIAKGFIPRGYLWHFDANVLGSLALVKEELLLGVKHTKGYLLWKQFLQTQN |
| J0C211 | 277-348 | LKALQAVLKDNDLGFDATELEQIAKGFIPRGYLWHFDANVLGNLALVREELLLGVKHTKGYSLWTEFLQKQN |
| M5YRX1 | 1-60 | None |
| O24903 | 425-496 | None |
| A0A1Q2PDB6 | 246-317 | None |
| A0A7U0RJ31 | 165-236 | None |
| A0A221JCP3 | 286-357 | None |
| J0K5T5 | 29-100 | None |
| A0A2T6P7S6 | 530-601 | None |
| A0A496FBY3 | 382-453 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.