DPCstruct | MC24227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 169 ± 11 aa |
| Standard deviation of domain lengths | 11.28 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5IBS1 | 18-195 | SSYADVAASGPKQTPEEAAAPQPPQIIPNESLTTSTSSLVDVDSQSVRTVPSDFMEQSVQTDTQQARIEREQEQEEREQQQHAREAS… |
| A0A4U0Y361 | 1-152 | MPEVEHSDVETSSLVDVDSPHVSSVPSDYETQSVKTDTQAERMEHEAEDRKRQAEQKAQEAKEKAAKAADKAKAKADEAADKIKKNS… |
| A0A093XPM6 | 47-222 | None |
| A0A0G2GWM7 | 1-195 | None |
| A0A094B2W2 | 164-339 | None |
| A0A0P7AKE0 | 115-281 | None |
| A0A4Q7JKX9 | 97-266 | None |
| A0A2U3EMA1 | 239-400 | None |
| K9F7C2 | 1-166 | None |
| A0A517L564 | 309-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.