DPCstruct | MC24223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 141 ± 14 aa |
| Standard deviation of domain lengths | 13.51 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C5WBM4 | 1-157 | MFYSQSLEVLNPAKAIREAKEKEANMDKPRICEVLGVEVGEKFTIADTDYWIEKNGAIFSDGNQRDLVGVSLICDVVNHPDRIIRKP… |
| A0A1Y4A175 | 2-123 | LGVGQGEKFCITYTSHSIKTTRICHIDENGNIVSDEGRLPAEALSQIINYPERIVKMTPLSDKEIEAIKAIKNLFPTAEYVEHIKNS… |
| A0A413FWS2 | 1-152 | None |
| A0A4Z0YF35 | 89-236 | None |
| A0A1Y4A8D2 | 152-278 | None |
| A0A212JT18 | 82-208 | None |
| A0A1C6CH76 | 61-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.