DPCstruct | MC24221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 367 ± 58 aa |
| Standard deviation of domain lengths | 57.62 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.48 |
| Pfam Score | 84.62 |
| Assigned Pfam label(s) | CL0020- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A024TJG8 | 10-286 | VCSTSTFASATGSALVAAVKAATTDCINSLFSVSGADAYSIFREAQMVSVADALRSAAATYQGNNSGSTAQLVLFLRAGYYVHYYDS… |
| Q81BX8 | 22-439 | NGLQIQAETKEKNVKNVLQMEPVGIQKSVDELAHPSKVQENESFTKRLKLADLSQRPLAPTDNIKPLAEEKKYSMAELNQLNNKQLT… |
| A0A369KMR6 | 25-442 | None |
| A0A3A8RRQ2 | 8-371 | None |
| A0A0F4J8P9 | 109-470 | None |
| B0TMN1 | 84-456 | None |
| A0A437QRK8 | 97-491 | None |
| A0A7C8CQJ5 | 1-442 | None |
| V6I489 | 1-347 | None |
| B1H4X4 | 10-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.