DPCstruct | MC2422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 68 ± 4 aa |
| Standard deviation of domain lengths | 3.79 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015KL31 | 1-64 | MSEAVSTFTTGNVSLTLADEIKKYKTDALIKFLQREEDLELDDDNLKVIREEKVNGRDFLKLTE |
| A0A2Z6SQK2 | 1-72 | MSKTSTPYTPASTSTTVTGNEMFSLADEIKKYKMKELIDFLRKKKDLGLDDDDLEIFRKRKIAGRTFLKMDK |
| A0A397SPL3 | 1-66 | None |
| A0A372Q4E0 | 1-65 | None |
| A0A372QPM1 | 1-66 | None |
| A0A2Z6RGN9 | 53-123 | None |
| A0A2Z6RL25 | 1-62 | None |
| A0A2H5S761 | 1-65 | None |
| A0A397J6L1 | 23-93 | None |
| A0A2N1N6K8 | 45-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.