DPCstruct | MC24213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 57 ± 4 aa |
| Standard deviation of domain lengths | 4.31 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 56.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287SZW0 | 1-52 | MQRVQNNEYWSLFCPNEAPGLADCWGEKFEELYKKYEKEGKAKKVIPAQTLW |
| A0A6P5RKG4 | 49-106 | ERVQNGGDWSLFCPNESPGLADCWGENFEELYTRYEREGKAKKVVQAQQLWFEILKSQ |
| R9AMV3 | 342-393 | None |
| A0A3Q0JD53 | 116-167 | None |
| A0A5P1F4L3 | 223-274 | None |
| A0A0N5D713 | 335-386 | None |
| A0A287I8W7 | 50-103 | None |
| A0A812YHU2 | 786-837 | None |
| X6PFR3 | 138-196 | None |
| A0A4V4MMT5 | 642-705 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.