DPCstruct | MC24212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 104 ± 21 aa |
| Standard deviation of domain lengths | 20.99 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 62.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2RHP4 | 3-111 | CAGKGSGTRCLGPARKRCGRCGAVSYCSASHQISHWKVHREECERLEQQMRNLDLLNDFPFTFSQESTVQISEKQESRCSFLRKRGI… |
| A0A287SYI0 | 1-126 | CAAKGLAEDPCTSGTHRRCGSCGAVAYCSKDHQFIHWKVHKEECARLATQMSRIDMLSQFPFTFSVEPLVLNNTNQSMRCLFLESIK… |
| A0A811NM29 | 142-219 | None |
| A0A453MGY1 | 67-177 | None |
| A0A453MGP4 | 60-179 | None |
| A0A4S8IA11 | 18-159 | None |
| A0A2T7EW36 | 1-108 | None |
| A0A2P2KDA0 | 1-79 | None |
| A0A7C9AI89 | 24-96 | None |
| A0A287SYG0 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.