DPCstruct | MC24211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 242 ± 24 aa |
| Standard deviation of domain lengths | 23.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A837A2Y3 | 1-214 | MDTPSQAANSISTAGSESFVDSSVIANNDQFFLLSFIIGNFFGPDLKGEGPKKSLFQRAAEGLSTYSLEQLTGGYIKTEEIEHIYYY… |
| A0A287SSG3 | 9-247 | QQRSHGIDFRAEHVVMDCLHGSYSSSLSLHGVRVDDEHSALENSSRPPSHINILTPKDVVPIEMARSRFLDIIIDHFIGQNAIEVAE… |
| A0A4D6N4Q2 | 1-273 | None |
| A0A287K5H6 | 201-452 | None |
| M8AP30 | 75-298 | None |
| A0A2N9INF6 | 42-320 | None |
| A0A443PSJ2 | 1-226 | None |
| A0A1Y1HU12 | 176-422 | None |
| A0A1Y1IID0 | 1-197 | None |
| A0A453TDB8 | 1-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.