DPCstruct | MC2421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 174 ± 23 aa |
| Standard deviation of domain lengths | 22.76 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03248 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6SDR6 | 14-193 | SGSNVWAHKAAFEKRYQKFLDEVTPHYAYRWIATVIILIIFMLRIFILQGFYIVTYALGIYLLNLFLAFLQPKFDPSLEMDITENEG… |
| A0A4Q9LLF9 | 7-166 | KTYFDRIVPMKRERWTFFGIVLFLFVLRIAIKRTHYLITYCLAIYLLHGLIGFCTPKEENIPDPFDNFEDDVYIPQTIDDDFKPFMR… |
| A0A6A7GBC3 | 23-204 | None |
| A0A7R8X5T7 | 386-557 | None |
| A0A6D2HUK9 | 4-186 | None |
| A0A453DMP4 | 2-141 | None |
| A0A0P1AVM7 | 509-688 | None |
| A0A1Q9DXF9 | 16-197 | None |
| A0A484GUT7 | 24-244 | None |
| A0A183TFM2 | 12-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.