DPCstruct | MC24209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 95 ± 13 aa |
| Standard deviation of domain lengths | 12.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0255 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833VMF3 | 126-222 | KTGFQVGEELGFYQGFIDVWNSVIQIDPEAFTPRVRKNITQLEKLVDGYPLMEPENENLQELLENIRLKFRVVCANLRVKLEYEGQP… |
| A0A287SPS0 | 1-97 | LSSFNLQQHLVYILGCLDVWMSVIRLDQDAFSARVRKYMEQLAALVSNYPLSDPEDEQLQGMMREIRLKFSVITGSLGAKLGYEGRP… |
| A0A7J9GN19 | 44-135 | None |
| A0A445FWY3 | 41-150 | None |
| A0A7J6EXW9 | 41-118 | None |
| A0A5N5GAR3 | 44-121 | None |
| A0A498J302 | 43-136 | None |
| A0A0D2MQM5 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.