DPCstruct | MC24208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 76 ± 15 aa |
| Standard deviation of domain lengths | 14.51 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 66.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287SNM7 | 8-72 | MVSQFMMELQGLKTVDGEDPPRILHFNPRLRGDWSGKPVIEQNTCYRMQWGTSLRCEGWMSRADE |
| A0A287SNL3 | 21-87 | SSQFMVELLGTKAVQGEEPPRILHFNPRLAGDFSGRPVIELNTCYRMQWALPQRCDGSASRPDHDTG |
| M7YUD8 | 1-67 | None |
| A0A5B6WNK1 | 1-67 | None |
| A0A811MI78 | 193-266 | None |
| A0A444EA12 | 487-559 | None |
| A0A445AVI7 | 52-119 | None |
| A0A804PGD1 | 186-268 | None |
| A0A5J5TZE7 | 235-299 | None |
| A0A287WVZ6 | 19-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.