DPCstruct | MC24207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 113 ± 23 aa |
| Standard deviation of domain lengths | 23.47 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 44.20 |
| Pfam Score | 68.42 |
| Assigned Pfam label(s) | CL0213- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287SNH3 | 15-115 | VKPRKGDALLFFSLHVNATTDPSSLHASCPVVEGEKWSATKWIHVRSFDNPPDVMTDAPCSDANEQCPRWAALGECYKNAKYMVGTK… |
| A0A6U2I9J9 | 129-237 | GNVAAKPKANDAALFYSYFPNGTMDEASMHTGCPVVKGIKWGAPVWIHVDEFRPEEMRGPARPTAAPRDPGVCADHSASCKTWAASG… |
| A0A314L4N3 | 15-104 | None |
| A0A6A1UZI5 | 73-150 | None |
| A0A7S3FA02 | 80-186 | None |
| A0A7S0KKA6 | 2-81 | None |
| A0A3Q7FA22 | 622-735 | None |
| A0A4P1RSU9 | 225-343 | None |
| A0A7N0RHM5 | 116-235 | None |
| A0A059ARU2 | 144-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.