DPCstruct | MC24206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 322 ± 45 aa |
| Standard deviation of domain lengths | 45.48 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 69.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U8FFN9 | 1-284 | MIFNMGGRPGQAVCKRLFERRGLCVNKLWQTKILQAADTDISALVEIEKSSMHRFEFFMGLVGDQPICARTAWAYGKAGGRISHALS… |
| A0A287SKZ6 | 2-311 | EDQFGLGLIARAVEEGIAIIKPMGIMIFSMGGRPGQGVCERVFLRRGLHINKLWQTKIMQAADVDISALVEIEKIYPHHFEFFMDLH… |
| A0A453HEG4 | 1-288 | None |
| A0A453HDX6 | 246-555 | None |
| A0A835S4E5 | 145-388 | None |
| A0A835S0G5 | 2-326 | None |
| A0A6V7P128 | 359-740 | None |
| A0A1D6FWK0 | 1-315 | None |
| A0A287MIW3 | 64-452 | None |
| A0A287SKZ3 | 1-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.