DPCstruct | MC24203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 80 ± 10 aa |
| Standard deviation of domain lengths | 9.66 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 66.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 57.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0114 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287S910 | 1-84 | EPLHTAAPEKRQRVPSAYNRFIKEEIRRIKANNPDISHREAFSTAAKNWAHFPNIHFGLGSNESSKKLDETIATPIPQKVQGLY |
| A0A804IKG5 | 85-144 | VQQQMLQIHPAEKRQRVPSAYNRFIKEEIRRLKATNPDISHREAFSTAAKNWAHLPSIHF |
| A0A836YFM9 | 155-220 | None |
| A2YMU8 | 66-129 | None |
| B6T787 | 121-215 | None |
| A0A1R3I6W4 | 118-201 | None |
| A0A2U1Q787 | 76-163 | None |
| A0A4Y1QZT4 | 88-160 | None |
| A0A3S3N1H8 | 87-174 | None |
| A0A059C530 | 195-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.