DPCstruct | MC24201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 320 ± 84 aa |
| Standard deviation of domain lengths | 84.10 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 77.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04782 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A392M337 | 1-244 | MYECHQVQKHIVQQLEYLNTIPSNNPTSEIHRQSTLQLELEVQQWHQSFCNLFKAHRDYIESLTGWLRLSLYQFSRNPLSRTAEESK… |
| A0A287S253 | 56-347 | MEKNRMEMESLESKMLVATQSIDTTTSEIIRLRESELFPQLLELVAGLMSMWRGMYECHQVQTHMVQQLEYLTMSTNPTSNDHRQAA… |
| A0A165XKC0 | 593-1000 | None |
| A0A5N6PAD5 | 124-570 | None |
| A0A5N6PN98 | 15-348 | None |
| A0A6P5MSM7 | 11-160 | None |
| A0A2P5Y6A9 | 6-242 | None |
| A0A6V7NS32 | 65-437 | None |
| A0A484MAR5 | 51-296 | None |
| A0A3S3NAT0 | 521-901 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.