DPCstruct | MC2420
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 238 ± 35 aa |
| Standard deviation of domain lengths | 35.07 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 36.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4QYE4 | 113-365 | LCGVWQIDGESIIEADGILEQLGICSYHFNHDQKNLHNPGFKKTKNTGQSILHRKRCLFCGKLFYFFTRGLGCEKHSWNIIGKNIQV… |
| A0A2Z6S9Y2 | 21-270 | MIGMWQIDDEEVRMKNFAIEHLGVCYSHFMFDQNQLHTSNLKQTKKYTESIIRRRRCLFCNKNKFFFSRGANCEEHSYTVIGKNIQI… |
| A0A2Z6RAN5 | 3-201 | None |
| A0A397IEF3 | 9-247 | None |
| A0A015KQT9 | 1-240 | None |
| A0A397IX34 | 318-578 | None |
| A0A397J548 | 214-541 | None |
| U9T1T8 | 114-337 | None |
| A0A2I1H5T2 | 32-253 | None |
| A0A2N0S4F8 | 396-653 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.