DPCstruct | MC242
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 104 ± 9 aa |
| Standard deviation of domain lengths | 9.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J7ZPG5 | 61-159 | RKKTELETTFYQLVEQWRGETRGVSSTEQLSMHSAYQQIIGMGSDVIPMLLRELERNSGRWFWALKSITREDPVTPEQQGKTKEMIE… |
| A0A2V9ILP8 | 14-117 | ARGRRRRSRHRQAEQHEHVFQELASKWRRETRHVSSLTRMAMHPAYQNIIGMGEPALPLILRELQENGGHWLWALHAITREDPAQEG… |
| A0A1F2VFG0 | 5-108 | None |
| A0A0F9C7Q9 | 88-208 | None |
| A0A0F9MMU6 | 3-97 | None |
| A0A7Y4YI58 | 3-96 | None |
| M6UEC6 | 162-262 | None |
| A0A7X3ZC55 | 204-311 | None |
| A0A1V4BY43 | 8-107 | None |
| A0A6P1GC62 | 20-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.