DPCstruct | MC24194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 133 ± 29 aa |
| Standard deviation of domain lengths | 28.68 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 67.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8I8V6 | 293-389 | VENTAFVLATERTRRRDPLNGFKLYNGGWNISDLHYLASVGFTAAPLFAVAAVWFFGFALVLSLICCCYCCFPRRSCSFSRTTCALS… |
| A0A0D9YNC7 | 13-148 | LLLLLIVLSLVVLAALLAAAAADASAVAGGGRSSPSTTTFVLAGERTRRKDPLDGLRLYSGGWNISDEHYWASVGFTAAPVFAAAAI… |
| A0A822YHN6 | 50-164 | None |
| A0A4S8JBB7 | 12-173 | None |
| A0A834Z731 | 22-131 | None |
| A0A445EMQ1 | 7-118 | None |
| A0A2P6RIH5 | 16-158 | None |
| A0A287NBN6 | 5-146 | None |
| A0A2I0VXX2 | 1-169 | None |
| A0A7J6GZE1 | 56-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.