DPCstruct | MC24193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 233 ± 48 aa |
| Standard deviation of domain lengths | 48.47 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 19.68 |
| Pfam Score | 96.97 |
| Assigned Pfam label(s) | PF19270- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6K5T7 | 108-352 | EFPDEVLKSVFPLLDGKDLVFCMLVCRQWHEIARDDYFWKCICSRKWPSICKQPPSGANYKKLYLTFSKPREMQNLPVPRLTFEDIV… |
| A0A0D9YG73 | 232-486 | TAPMLGSEPPWLVLRLVGPFLDAESLAAASCVSTACREAFTAEDLWSKLLRSQYPSALGLLPMQGNGDDASGRSSSPYRRLFALFRS… |
| A0A7J7DVU0 | 9-245 | None |
| A0A5J4YXE2 | 115-504 | None |
| M4C8I9 | 49-287 | None |
| A0A835R811 | 17-199 | None |
| A0A835RBP7 | 1-235 | None |
| A0A2R6X6D3 | 1-228 | None |
| A0A2Z6M2W2 | 3-250 | None |
| A0A2Z6M7Z9 | 18-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.