DPCstruct | MC24190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 85 ± 11 aa |
| Standard deviation of domain lengths | 10.83 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2PEA9 | 92-186 | KRKKYGMILLAFALNKAKEQGIKALLMEGNYDFYSKLGFERAKDKNILYYGSTVDFLLYKELEEGYLKDCDQANYMTPKVYYVDEKE… |
| A0A1I0RYD7 | 11-100 | LINAMIYKAKSLGFGAILFFGRPEYYPQFGFKEASVFGITDSEGYNYTAFMSMELIPNYLTIAYGGKYYESDIYNDEINRDKVKAFD… |
| A0A2U3KEA1 | 253-344 | None |
| S3T943 | 266-353 | None |
| A0A524RME4 | 34-93 | None |
| A0A1H6LL56 | 82-197 | None |
| A0A849E8F4 | 2-73 | None |
| A0A424L324 | 60-146 | None |
| A0A449GAD7 | 101-180 | None |
| A0A2S2F6V5 | 2-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.