DPCstruct | MC24188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 173 ± 24 aa |
| Standard deviation of domain lengths | 23.58 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6TZS7 | 85-239 | ENIKSNITELYNDISEGITDDLDVENKIKGNKWMASDGSVLELKDDGTYYWYEDENDKSDNYYEGEYTVSLGDSAIEQINEEYVFNE… |
| A0A1I0QU61 | 1-223 | MNNNNNYNNQNPQQYGYFNNNGQPLNPKKKRISTGGIVAIVIGAVTSIAFMFVSSLILGGYLAKNIESYVESYYSLSEGIVSKPDGF… |
| E7GEY2 | 10-150 | None |
| A0A1Q6K4X0 | 18-208 | None |
| A0A1H9HT03 | 40-204 | None |
| A0A2G6NYQ3 | 105-285 | None |
| A0A847CK16 | 1-166 | None |
| A0A373BWE5 | 18-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.