DPCstruct | MC24181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 216 |
|---|---|
| Mean domain length (aa) | 198 ± 26 aa |
| Standard deviation of domain lengths | 25.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.28 |
| Pfam Score | 99.66 |
| Assigned Pfam label(s) | PF02759- CL0321 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183B6U6 | 4-159 | TPAQFGVIKKCILDVHQKQIKTLDDQMSVVRDLCEAIESLFRLGLTNRSRTRDYYSWMEDLMKKLKQEKSFIHPDFSAALKSVRKNN… |
| A0A195DAR9 | 7-179 | LIKELKGWTRKLIEHAKEITDENENLCHFCKCLENCLQKDLLPIFDSVGYFKISYAWHWLEYVSRKNYNGYNTFLLAVEQVKQNAKV… |
| A0A0M3IJ10 | 23-178 | None |
| A0A1I8ICM0 | 1-177 | None |
| A0A1I8INM6 | 95-289 | None |
| A0A1I8IQR4 | 181-392 | None |
| A0A1I8IS31 | 59-275 | None |
| E9FRQ9 | 683-869 | None |
| A0A1D2NG03 | 1-198 | None |
| A0A819MZ59 | 141-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.