DPCstruct | MC2418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 510 ± 83 aa |
| Standard deviation of domain lengths | 83.22 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6QUJ1 | 1-510 | MDSSTFSALRINFLSSGSVVSFNNTNLITNTGFFAQSLSLKSLQYGGFIMITMDLTTSVYVNFFNENGTADGGPINTHQMNTYLILP… |
| A0A2Z6S8G4 | 60-597 | DIDYICDAAYTSTGGMCLLKIRKIKHNETSKLHLLKISFQNSGSVSSVNKFINPMGINDTDNIMFNYLYYGGYLVRIFNKIENSDNS… |
| A0A015L935 | 178-528 | None |
| A0A397SW03 | 207-711 | None |
| A0A015KY04 | 370-908 | None |
| U9U3I5 | 4-400 | None |
| A0A2N0SD53 | 3-371 | None |
| A0A1Y1XS56 | 213-810 | None |
| A0A2N1NKA2 | 1-612 | None |
| A0A397UF16 | 46-506 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.