DPCstruct | MC24176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 122 |
|---|---|
| Mean domain length (aa) | 84 ± 9 aa |
| Standard deviation of domain lengths | 9.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10387 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4AZX9 | 3-81 | DVIGLRRLGDYRLELAFSDGTIGVRDFSFVRQKSGPMAEPLKDPAYFARVIIHDGALTWPNGYDWDPIALHDEMQAAGL |
| A0A850A474 | 6-89 | DVIDFAFVGDYVLRVRFDDGVERIIDFAPILLGPLFGPLHDPSLFRQVRVDRDLGTLVWPNGADIDPTVLYDWLQHVDAIVQRR |
| A0A849ST80 | 4-79 | None |
| A0A349MEN3 | 60-142 | None |
| B0UEG0 | 9-97 | None |
| A0A285U290 | 1-85 | None |
| A0A1H8Z2G6 | 121-206 | None |
| A0A258EVD0 | 1-77 | None |
| A0A2N2ULT1 | 56-143 | None |
| A0A0S6VUZ5 | 2-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.