DPCstruct | MC24171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 6.58 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 41.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9C439 | 5-74 | KHYYRDLGAQLWGIYGLRDAYNPGQDWVSDIFMGLNQAPITVMIENYRTGLVWKSFMSNPEIGEMLKKLE |
| X1NXR6 | 1-73 | MYEKFGDKIWGEYGFVDAFNPHLDWYDDGFIGIDKGNEVLMIENFRNEGVWKVFMQNPYVAEGMKKAKFSNNK |
| A0A2E6NA59 | 98-166 | None |
| A0A838MU52 | 2-74 | None |
| A0A7J2J8M8 | 187-253 | None |
| A0A1F9U2H0 | 172-234 | None |
| A0A7C1D3H1 | 182-256 | None |
| A0A8B3S0N7 | 198-277 | None |
| T1CP71 | 101-190 | None |
| A0A1Q8B6M8 | 2-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.