DPCstruct | MC2417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 243 ± 51 aa |
| Standard deviation of domain lengths | 51.37 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 75.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8MJ52 | 46-300 | VKRPCPGLTATLDPKIGIYLESCMSEGGGSKSRQYFSEQMFDGKEWSELTEEEKRLVNTAHIQACTWRNVSEPTVMAIFACGENPCV… |
| A0A2Z6S2G2 | 197-403 | CQGLSNDQIKHYILHYPSDFGGSKRETELACQLFPQKFKDGHLVYSKLNPDERQELYSLQRAHATWFLDQGNLSVTSAKCKKFTAHE… |
| A0A2H5SEF6 | 365-653 | None |
| A0A2S4VW06 | 78-258 | None |
| A0A2Z6RFI2 | 327-545 | None |
| A0A2I1F2I3 | 18-281 | None |
| A0A372QHB9 | 4-246 | None |
| A0A1V9YWP7 | 513-799 | None |
| A0A369JTQ8 | 38-289 | None |
| A0A1V9ZVJ7 | 154-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.