DPCstruct | MC24169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 58 ± 7 aa |
| Standard deviation of domain lengths | 6.74 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842W3T9 | 316-363 | IPRYCPKCGNYNQRMIFERTDRNNILLDYPRIYGLKTVCGNCGCEWNQ |
| X1NXF6 | 25-82 | DILTVPKPEGRRKCPKCGEVLKHMIHESVDKGVIVLDYPRIWGKKYKCGKCGCEWREK |
| A0A524FMP4 | 189-245 | None |
| A0A5B9DAH5 | 1-59 | None |
| A0A1Q9MQE3 | 335-410 | None |
| A0A7K4HEQ8 | 282-338 | None |
| A0A524DIS7 | 426-484 | None |
| A0A7C1NA87 | 77-133 | None |
| A0A842VVB2 | 2-54 | None |
| A0A0F9MYH4 | 101-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.