DPCstruct | MC24168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 188 ± 35 aa |
| Standard deviation of domain lengths | 34.93 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 14.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4PRB0 | 11-225 | SLVGEINRLRDKFADAVKAITHYQDSRSEILHQVYPWLVTLQVSRNIRIVTEQIRSLGFTWQIPVIHKFTRLETVIDRLRREIIELQ… |
| A0A0A0H2E9 | 5-197 | QVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDPATLRFGWANKHIIKNLHRDEVL… |
| A0A854LWM4 | 25-212 | None |
| A0A5M9NWP3 | 1-256 | None |
| A0A377B007 | 44-215 | None |
| A0A6I1IS70 | 14-145 | None |
| A0A1I5Z2M0 | 1-206 | None |
| A0A3S4JKL9 | 1-177 | None |
| A0A494UCW8 | 7-177 | None |
| A0A1Z7ZXT0 | 75-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.